Online Inquiry

CD14 (Recombinant)

Catalog No: PT011    Size: 0.2 mL
Online Inquiry
Product Description Human CD14 (monocyte differentiation antigen CD14) is a 375 amino acid, phospholipid anchored cell surface protein. This protein is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide.
State Solution
Concentration 0.5 mg/mL
Purity > 90%
Formulation Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol
Sterilization Method Filtration
Storage/Stability -20 °C
Shelf Life Minimum of 6 months from date of receipt
Accession Number NP_000582
Sequence MASMTGGQQMGRGHHHHHHGNLYFQGTTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN
Datasheet
! For Research/Industry Use Only!

Related Products

inquiry