CD40 (Recombinant)
Catalog No: PT013
Size: 0.2 mL
Online Inquiry
| Product Description | Human CD40 (TNRRSF5: tumor necrosis factor receptor superfamily member 5, isoform 2) is a 203 amino acid cell surface protein. This protein belongs to a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
| State | Solution |
| Concentration | 0.5 mg/mL |
| Purity | > 90% |
| Formulation | Formulated in 20 mM pH 8.0 TRIS-HCL Buffer, with proprietary formulation of NaCl, KCl, EDTA, L-Arginine, DTT and Glycerol |
| Sterilization Method | Filtration |
| Storage/Stability | -20 °C |
| Shelf Life | Minimum of 6 months from date of receipt |
| Accession Number | NP_690593 |
| Sequence | MASMTGGQQMGRGHHHHHHGNLYFQGGEFELEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTRSPGSAESPGGDPHHLRDPVCHPLGAGL |
! For Research/Industry Use Only!